PSMD14 Antibody (4A10-E8) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related PSMD14 Primary Antibodies

Order Details


    • Catalog Number
      H00010213-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PSMD14 Antibody (4A10-E8) [DyLight 755] Summary

Immunogen
PSMD14 (AAH09524, 1 a.a. ~ 96 a.a) full length recombinant protein with GST tag.MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNK AVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQC LAAMLDTVVFK
Localization
Cytoplasmic and Nuclear
Specificity
PSMD14 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMD14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 755
Format
DyLight 755 (A=754, E=776)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSMD14 Antibody (4A10-E8) [DyLight 755]

  • EC 3.1.2.15
  • EC 3.4.19.-
  • pad1
  • POH126S proteasome non-ATPase regulatory subunit 14,26S proteasome regulatory subunit RPN11
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  • Rpn11
  • RPN11,26S proteasome-associated PAD1 homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7257
Species: Hu
Applications: IHC
AF5650
Species: Hu
Applications: WB, IHC
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-92240
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85656
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
H00010213-M01IR
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PSMD14 Antibody (H00010213-M01IR) (0)

There are no publications for PSMD14 Antibody (H00010213-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD14 Antibody (H00010213-M01IR) (0)

There are no reviews for PSMD14 Antibody (H00010213-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD14 Antibody (H00010213-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMD14 Antibody (4A10-E8) [DyLight 755] Products

Related Products by Gene

Bioinformatics Tool for PSMD14 Antibody (H00010213-M01IR)

Discover related pathways, diseases and genes to PSMD14 Antibody (H00010213-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD14 Antibody (H00010213-M01IR)

Discover more about diseases related to PSMD14 Antibody (H00010213-M01IR).
 

Pathways for PSMD14 Antibody (H00010213-M01IR)

View related products by pathway.

PTMs for PSMD14 Antibody (H00010213-M01IR)

Learn more about PTMs related to PSMD14 Antibody (H00010213-M01IR).
 

Research Areas for PSMD14 Antibody (H00010213-M01IR)

Find related products by research area.

Blogs on PSMD14

There are no specific blogs for PSMD14, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PSMD14

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00010213-M01IR below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.