PSMD12 Antibody

Images

 
Western Blot: PSMD12 Antibody [NBP1-56980] - HCT15 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PSMD12 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56980
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PSMD12 Antibody Summary

Immunogen
Synthetic peptides corresponding to PSMD12 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 12) The peptide sequence was selected from the N terminal of PSMD12. Peptide sequence MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL.
Specificity
This product is specific to Subunit or Isoform: 12.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSMD12 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSMD12 Antibody

  • 26S proteasome non-ATPase regulatory subunit 12
  • 26S proteasome regulatory subunit p55
  • 26S proteasome regulatory subunit RPN5
  • MGC75406
  • p55
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
  • Rpn5

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
7270-IL/CF
Species: Hu
6507-IL/CF
Species: Hu
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PSMD12 Antibody (NBP1-56980) (0)

There are no publications for PSMD12 Antibody (NBP1-56980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD12 Antibody (NBP1-56980) (0)

There are no reviews for PSMD12 Antibody (NBP1-56980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMD12 Antibody (NBP1-56980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PSMD12 Products

Bioinformatics Tool for PSMD12 Antibody (NBP1-56980)

Discover related pathways, diseases and genes to PSMD12 Antibody (NBP1-56980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD12 Antibody (NBP1-56980)

Discover more about diseases related to PSMD12 Antibody (NBP1-56980).
 

Pathways for PSMD12 Antibody (NBP1-56980)

View related products by pathway.

Blogs on PSMD12

There are no specific blogs for PSMD12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD12