Recombinant Human PSMC6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PSMC6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 290-389 of Human PSMC6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PSMC6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PSMC6 Protein

  • 26S protease regulatory subunit 10B
  • 26S protease regulatory subunit S10B
  • 26S proteasome AAA-ATPase subunit RPT4
  • CADP44
  • conserved ATPase domain protein 44
  • MGC12520
  • p42
  • P44
  • proteasome (prosome, macropain) 26S subunit, ATPase, 6
  • Proteasome 26S subunit ATPase 6
  • Proteasome subunit p42
  • SUG2

Background

PSMC6 - proteasome (prosome, macropain) 26S subunit, ATPase, 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for PSMC6 Partial Recombinant Protein (H00005706-Q01) (0)

There are no publications for PSMC6 Partial Recombinant Protein (H00005706-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMC6 Partial Recombinant Protein (H00005706-Q01) (0)

There are no reviews for PSMC6 Partial Recombinant Protein (H00005706-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMC6 Partial Recombinant Protein (H00005706-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMC6 Products

Bioinformatics Tool for PSMC6 Partial Recombinant Protein (H00005706-Q01)

Discover related pathways, diseases and genes to PSMC6 Partial Recombinant Protein (H00005706-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMC6 Partial Recombinant Protein (H00005706-Q01)

Discover more about diseases related to PSMC6 Partial Recombinant Protein (H00005706-Q01).
 

Pathways for PSMC6 Partial Recombinant Protein (H00005706-Q01)

View related products by pathway.

Blogs on PSMC6

There are no specific blogs for PSMC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PSMC6 Antibody (2C4)
H00005706-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PSMC6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC6