PSMA/FOLH1/NAALADase I Antibody

Images

 
Western Blot: PSMA Antibody [NBP1-69298] - Human placenta tissue lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMA/FOLH1/NAALADase I Antibody Summary

Immunogen
Synthetic peptides corresponding to FOLH1(folate hydrolase (prostate-specific membrane antigen) 1) The peptide sequence was selected from the C terminal of FOLH1 (NP_004467). Peptide sequence FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOLH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSMA/FOLH1/NAALADase I Antibody

  • Cell growth-inhibiting gene 27 protein
  • cell growth-inhibiting protein 27
  • EC 3.4.17.21
  • FGCP
  • folate hydrolase (prostate-specific membrane antigen) 1
  • Folate hydrolase 1
  • FOLH1
  • FOLHNAALADase I
  • Folylpoly-gamma-glutamate carboxypeptidase
  • GCP2
  • GCPII
  • GCPIImGCP
  • glutamate carboxylase II
  • glutamate carboxypeptidase 2
  • Glutamate carboxypeptidase II
  • Membrane glutamate carboxypeptidase
  • mopsm
  • NAALAD1
  • NAALAD1N-acetylated-alpha-linked acidic dipeptidase I
  • NAALADase I
  • NAALAdase
  • N-acetylated alpha-linked acidic dipeptidase 1
  • prostate specific membrane antigen variant F
  • Prostate-specific membrane antigen
  • PSMA
  • PSMAFGCP
  • PSMPteroylpoly-gamma-glutamate carboxypeptidase

Background

FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. A mutation in the gene encoding FOLH1 may be associated with impaired intestinal absorption of dietary folates.It is used as an effective diagnostic and prognostic indicator of prostate cancer.This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
MAB6240
Species: Hu
Applications: WB, IHC
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-74730
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
MAB7636
Species: Hu
Applications: IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298) (0)

There are no publications for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298) (0)

There are no reviews for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMA/FOLH1/NAALADase I Products

Bioinformatics Tool for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298)

Discover related pathways, diseases and genes to PSMA/FOLH1/NAALADase I Antibody (NBP1-69298). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298)

Discover more about diseases related to PSMA/FOLH1/NAALADase I Antibody (NBP1-69298).
 

Pathways for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298)

View related products by pathway.

PTMs for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298)

Learn more about PTMs related to PSMA/FOLH1/NAALADase I Antibody (NBP1-69298).
 

Research Areas for PSMA/FOLH1/NAALADase I Antibody (NBP1-69298)

Find related products by research area.

Blogs on PSMA/FOLH1/NAALADase I

There are no specific blogs for PSMA/FOLH1/NAALADase I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMA/FOLH1/NAALADase I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOLH1
Entrez
Uniprot