PSENEN/PEN2 Antibody

Images

 
Western Blot: PEN2 Antibody [NBP1-69150] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PSENEN/PEN2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69150
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PSENEN/PEN2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PSENEN (presenilin enhancer 2 homolog (C. elegans)) The peptide sequence was selected from the C terminal of PSENEN. Peptide sequence SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT.
Specificity
This product is specific to Subunit or Isofrom: PEN-2.
Clonality
Polyclonal
Host
Rabbit
Gene
PSENEN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSENEN and was validated on Western blot.
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSENEN/PEN2 Antibody

  • gamma-secretase subunit PEN-2
  • MSTP064
  • PEN-2
  • PEN2hematopoietic stem/progenitor cells protein MDS033
  • presenilin enhancer 2 homolog (C. elegans)
  • Presenilin enhancer protein 2
  • PSENEN

Background

Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-77270
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
H00004782-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15039
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PSENEN/PEN2 Antibody (NBP1-69150) (0)

There are no publications for PSENEN/PEN2 Antibody (NBP1-69150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSENEN/PEN2 Antibody (NBP1-69150) (0)

There are no reviews for PSENEN/PEN2 Antibody (NBP1-69150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSENEN/PEN2 Antibody (NBP1-69150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSENEN/PEN2 Products

Bioinformatics Tool for PSENEN/PEN2 Antibody (NBP1-69150)

Discover related pathways, diseases and genes to PSENEN/PEN2 Antibody (NBP1-69150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSENEN/PEN2 Antibody (NBP1-69150)

Discover more about diseases related to PSENEN/PEN2 Antibody (NBP1-69150).
 

Pathways for PSENEN/PEN2 Antibody (NBP1-69150)

View related products by pathway.

PTMs for PSENEN/PEN2 Antibody (NBP1-69150)

Learn more about PTMs related to PSENEN/PEN2 Antibody (NBP1-69150).
 

Research Areas for PSENEN/PEN2 Antibody (NBP1-69150)

Find related products by research area.

Blogs on PSENEN/PEN2

There are no specific blogs for PSENEN/PEN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSENEN/PEN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSENEN
Entrez
Uniprot