PRPSAP2 Antibody

Images

 
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml PRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Hela Whole Cell lysates, Antibody Dilution: 2.0 ug/ml PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml PRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml PRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: PRPSAP2 Antibody [NBP1-56292] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:100 Positive Control: HepG2 cell lysate

Product Details

Summary
Product Discontinued
View other related PRPSAP2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56292
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PRPSAP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRPSAP2(phosphoribosyl pyrophosphate synthetase-associated protein 2) The peptide sequence was selected from the N terminal of PRPSAP2. Peptide sequence MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPSAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRPSAP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRPSAP2 Antibody

  • MGC117304
  • MGC126719
  • MGC126721
  • PAP4141 kDa phosphoribosypyrophosphate synthetase-associated protein
  • phosphoribosyl pyrophosphate synthase-associated protein 2
  • phosphoribosyl pyrophosphate synthetase-associated protein 2
  • PRPP synthase-associated protein 2

Background

The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalyt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32625
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13813
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57669
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91959
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-86794
Species: Hu
Applications: WB, ICC/IF
NBP1-91717
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-08234
Species: Hu
NBP2-65749
Species: Hu
NBP2-65899
Species: Hu
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-56292
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for PRPSAP2 Antibody (NBP1-56292) (0)

There are no publications for PRPSAP2 Antibody (NBP1-56292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPSAP2 Antibody (NBP1-56292) (0)

There are no reviews for PRPSAP2 Antibody (NBP1-56292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRPSAP2 Antibody (NBP1-56292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PRPSAP2 Products

Bioinformatics Tool for PRPSAP2 Antibody (NBP1-56292)

Discover related pathways, diseases and genes to PRPSAP2 Antibody (NBP1-56292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPSAP2 Antibody (NBP1-56292)

Discover more about diseases related to PRPSAP2 Antibody (NBP1-56292).

Blogs on PRPSAP2

There are no specific blogs for PRPSAP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPSAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPSAP2
Uniprot