PRP19 Antibody

Images

 
Western Blot: PRP19 Antibody [NBP1-53005] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Product Discontinued
View other related PRP19 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53005
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PRP19 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRPF19(PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of PRPF19. Peptide sequence VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVA
Clonality
Polyclonal
Host
Rabbit
Gene
PRPF19
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRPF19 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRP19 Antibody

  • hPSO4
  • NMP200SNEV
  • Nuclear matrix protein 200
  • nuclear matrix protein NMP200 related to splicing factor PRP19
  • pre-mRNA-processing factor 19
  • PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
  • PRP19PRP19/PSO4 homolog (S. cerevisiae)
  • PSO4PRP19/PSO4 homolog
  • Senescence evasion factor
  • UBOX4

Background

PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58313
Species: Hu
Applications: WB, ICC/IF
NBP1-06556
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89663
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40681
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-85379
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PRP19 Antibody (NBP1-53005) (0)

There are no publications for PRP19 Antibody (NBP1-53005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRP19 Antibody (NBP1-53005) (0)

There are no reviews for PRP19 Antibody (NBP1-53005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRP19 Antibody (NBP1-53005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRP19 Products

Bioinformatics Tool for PRP19 Antibody (NBP1-53005)

Discover related pathways, diseases and genes to PRP19 Antibody (NBP1-53005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRP19 Antibody (NBP1-53005)

Discover more about diseases related to PRP19 Antibody (NBP1-53005).
 

Pathways for PRP19 Antibody (NBP1-53005)

View related products by pathway.

PTMs for PRP19 Antibody (NBP1-53005)

Learn more about PTMs related to PRP19 Antibody (NBP1-53005).
 

Research Areas for PRP19 Antibody (NBP1-53005)

Find related products by research area.

Blogs on PRP19

There are no specific blogs for PRP19, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRP19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF19
Uniprot