Prox1 Antibody (1H6)

Images

 
Western Blot: Prox1 Antibody (1H6) [H00005629-M09] - Analysis of PROX1 expression in MCF-7 (Cat # L046V1).
Western Blot: Prox1 Antibody (1H6) [H00005629-M09] - Analysis of PROX1 expression in SW-13 (Cat # L005V1).
Western Blot: Prox1 Antibody (1H6) [H00005629-M09] - Analysis of PROX1 expression in Hela S3 NE.
Western Blot: Prox1 Antibody (1H6) [H00005629-M09] - Analysis of PROX1 expression in human skeletal muscle.
Sandwich ELISA: Prox1 Antibody (1H6) [H00005629-M09] - Detection limit for recombinant GST tagged PROX1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Prox1 Antibody (1H6) Summary

Immunogen
PROX1 (NP_002754.2 638 a.a. - 737 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
Specificity
PROX1 (1H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PROX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Prox1 Antibody (1H6)

  • Homeobox prospero-like protein PROX1
  • prospero homeobox 1
  • prospero homeobox protein 1
  • prospero-related homeobox 1
  • Prox1
  • PROX-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF2125
Species: Mu
Applications: WB, IHC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
H00006496-M04
Species: Hu
Applications: WB, ELISA
NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00002301-R01
Species: Hu
AF2567
Species: Mu
Applications: WB, IHC

Publications for Prox1 Antibody (H00005629-M09) (0)

There are no publications for Prox1 Antibody (H00005629-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prox1 Antibody (H00005629-M09) (0)

There are no reviews for Prox1 Antibody (H00005629-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prox1 Antibody (H00005629-M09). (Showing 1 - 1 of 1 FAQ).

  1. Can you provide a little amount of aliquots of each anti-Prox1 antibody? I am studying about Prox1 using zebrafish animal model. I want to test prox1 antibody of your company in zebrafish embryo by whole mount immunostaining. I want to test all of prox1 antibody produced by your company and then I want to buy it which works well in zebrafish species. In many case antibodies do not work in zebrafish.
    • I am unable to provide you with a free sample of this antibody. However, based on sequence similarity of the immunogen, this antibody was generated against a sequence that is 97% similar to zebrafish so this antibody should work on zebrafish. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Secondary Antibodies

 

Isotype Controls

Additional Prox1 Products

Bioinformatics Tool for Prox1 Antibody (H00005629-M09)

Discover related pathways, diseases and genes to Prox1 Antibody (H00005629-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prox1 Antibody (H00005629-M09)

Discover more about diseases related to Prox1 Antibody (H00005629-M09).
 

Pathways for Prox1 Antibody (H00005629-M09)

View related products by pathway.

PTMs for Prox1 Antibody (H00005629-M09)

Learn more about PTMs related to Prox1 Antibody (H00005629-M09).
 

Research Areas for Prox1 Antibody (H00005629-M09)

Find related products by research area.

Blogs on Prox1.

Podoplanin (OST8, Glycoprotein (Gp) 36 or 38, Lung Type I Cell Membrane Associated Glycoprotein)
Podoplanin is a mucin-type 1 transmembrane glycoprotein found in a wide range of tissues. It appears to be differentially expressed in endothelial cells of lymphatic but not blood vessel origin. In normal skin and kidney, podoplanin co-localizes with...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prox1 Antibody (1H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PROX1
Entrez
OMIM
Uniprot