Recombinant Human Protocadherin-8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Protocadherin-8 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 32 - 120 of Human PCDH8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDH8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Protocadherin-8 Protein

  • Arcadlin
  • PAPC
  • PCDH8
  • protocadherin 8
  • Protocadherin8
  • Protocadherin-8

Background

PCDH8 - protocadherin 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
AF7669
Species: Hu, Mu, Rt
Applications: WB
AF198
Species: Mu
Applications: WB, IHC
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
NBL1-14149
Species: Hu
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA

Publications for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01) (0)

There are no publications for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01) (0)

There are no reviews for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protocadherin-8 Products

Bioinformatics Tool for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01)

Discover related pathways, diseases and genes to Protocadherin-8 Partial Recombinant Protein (H00005100-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01)

Discover more about diseases related to Protocadherin-8 Partial Recombinant Protein (H00005100-Q01).
 

Pathways for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01)

View related products by pathway.

PTMs for Protocadherin-8 Partial Recombinant Protein (H00005100-Q01)

Learn more about PTMs related to Protocadherin-8 Partial Recombinant Protein (H00005100-Q01).

Blogs on Protocadherin-8

There are no specific blogs for Protocadherin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protocadherin-8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH8
Entrez