Recombinant Human Protocadherin 21 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Protocadherin 21 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 113 - 211 of Human PCDH21 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLNLVAEKVVILVTDANDEAPRFIQEPYVALVPEDIPAGSIIFKVHAVDRDTGSGGSVTYFLQNLHSPFAVDRHSGVLRLQAGATLDYERSRTHYITVV

Protein/Peptide Type
Partial Recombinant Protein
Gene
CDHR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Protocadherin 21 Protein

  • cadherin-related family member 1
  • CORD15
  • KIAA1775DKFZp434A132
  • PCDH21MT-protocadherin
  • Photoreceptor cadherin
  • prCAD
  • PRCADprotocadherin-21
  • protocadherin 21
  • Protocadherin-21

Background

PCDH21 - protocadherin 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92296
Species: Hu
Applications: IHC, IHC-P
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13901
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
AF6729
Species: Hu
Applications: WB, IHC, ICC
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB

Publications for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01) (0)

There are no publications for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01) (0)

There are no reviews for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protocadherin 21 Products

Bioinformatics Tool for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01)

Discover related pathways, diseases and genes to Protocadherin 21 Partial Recombinant Protein (H00092211-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin 21 Partial Recombinant Protein (H00092211-Q01)

Discover more about diseases related to Protocadherin 21 Partial Recombinant Protein (H00092211-Q01).

Blogs on Protocadherin 21

There are no specific blogs for Protocadherin 21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protocadherin 21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDHR1