Protocadherin-1 Antibody (5D5) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Protocadherin-1 Primary Antibodies

Order Details


    • Catalog Number
      H00005097-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Protocadherin-1 Antibody (5D5) [PerCP] Summary

Immunogen
PCDH1 (NP_002578 62 a.a. - 169 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
Localization
Cell junction. Cell membrane. Single-pass type I membrane protein. Note=Found at cell-cell boundaries and probably at cell-matrix boundaries.
Specificity
PCDH1 - protocadherin 1 (cadherin-like 1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCDH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin-1 Antibody (5D5) [PerCP]

  • cadherin-like 1
  • Cadherin-like protein 1
  • FLJ53887
  • MGC45991
  • PC42
  • PC42PCDH42
  • PCDH1
  • PCDH42
  • protocadherin 1 (cadherin-like 1)
  • protocadherin 1
  • protocadherin 42
  • Protocadherin1
  • Protocadherin-1
  • protocadherin-42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
AF5434
Species: Hu
Applications: WB, ICC
NBP2-04544
Species: Hu
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NBL1-14149
Species: Hu
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB8364
Species: Hu
Applications: WB
NBP2-30010
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
6774-CA
Species: Hu
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for Protocadherin-1 Antibody (H00005097-M01PCP) (0)

There are no publications for Protocadherin-1 Antibody (H00005097-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-1 Antibody (H00005097-M01PCP) (0)

There are no reviews for Protocadherin-1 Antibody (H00005097-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protocadherin-1 Antibody (H00005097-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin-1 Products

Bioinformatics Tool for Protocadherin-1 Antibody (H00005097-M01PCP)

Discover related pathways, diseases and genes to Protocadherin-1 Antibody (H00005097-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-1 Antibody (H00005097-M01PCP)

Discover more about diseases related to Protocadherin-1 Antibody (H00005097-M01PCP).
 

Pathways for Protocadherin-1 Antibody (H00005097-M01PCP)

View related products by pathway.

PTMs for Protocadherin-1 Antibody (H00005097-M01PCP)

Learn more about PTMs related to Protocadherin-1 Antibody (H00005097-M01PCP).

Blogs on Protocadherin-1

There are no specific blogs for Protocadherin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-1 Antibody (5D5) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH1
Entrez