Prothrombin Antibody

Images

 
Western Blot: Prothrombin Antibody [NBP1-74142] - Titration: 1.0 ug/ml Positive Control: Rat Lung.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prothrombin Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of F2. Immunizing peptide sequence CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against F2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Prothrombin Antibody

  • coagulation factor II (thrombin)
  • Coagulation factor II
  • EC 3.4.21
  • EC 3.4.21.5
  • prothrombin B-chain
  • prothrombin
  • PT
  • serine protease

Background

F2 catalyzes the preferential cleavage of Arg-Gly; activates fibrinogen to fibrin and releases fibrinopeptides A and B; involved in blood coagulation and wound repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP2-07799
Species: Hu
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for Prothrombin Antibody (NBP1-74142) (0)

There are no publications for Prothrombin Antibody (NBP1-74142).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prothrombin Antibody (NBP1-74142) (0)

There are no reviews for Prothrombin Antibody (NBP1-74142). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prothrombin Antibody (NBP1-74142) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prothrombin Products

Bioinformatics Tool for Prothrombin Antibody (NBP1-74142)

Discover related pathways, diseases and genes to Prothrombin Antibody (NBP1-74142). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prothrombin Antibody (NBP1-74142)

Discover more about diseases related to Prothrombin Antibody (NBP1-74142).
 

Pathways for Prothrombin Antibody (NBP1-74142)

View related products by pathway.

PTMs for Prothrombin Antibody (NBP1-74142)

Learn more about PTMs related to Prothrombin Antibody (NBP1-74142).

Blogs on Prothrombin.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prothrombin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol F2
Entrez
Uniprot