Recombinant Human Proteoglycan 4 Protein

Images

 
SDS-Page: Recombinant Human Proteoglycan 4 Protein [H00010216-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Proteoglycan 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1305-1404 of Human PRG4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRG4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010216-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Proteoglycan 4 Protein

  • bG174L6.2 (MSF: megakaryocyte stimulating factor )
  • bG174L6.2
  • CACP
  • FLJ32635
  • JCAP
  • lubricin
  • megakaryocyte stimulating factor
  • Megakaryocyte-stimulating factor
  • MSFproteoglycan 4, (megakaryocyte stimulating factor, articular superficial zoneprotein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)
  • proteoglycan 4
  • Superficial zone proteoglycan
  • SZPHAPOarticular superficial zone protein

Background

PRG4 - proteoglycan 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89076
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00010216-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01)(1)

Reviews for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01) (0)

There are no reviews for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteoglycan 4 Products

Bioinformatics Tool for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01)

Discover related pathways, diseases and genes to Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01)

Discover more about diseases related to Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01).
 

Pathways for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01)

View related products by pathway.

PTMs for Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01)

Learn more about PTMs related to Proteoglycan 4 Partial Recombinant Protein (H00010216-Q01).

Blogs on Proteoglycan 4

There are no specific blogs for Proteoglycan 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Proteoglycan 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRG4