Protein S/PROS1 Antibody

Images

 
Western Blot: Protein S Antibody [NBP1-74073] - Rat Muscle Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related Protein S/PROS1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74073
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Protein S/PROS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Pros1. Immunizing peptide sequence LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS.
Clonality
Polyclonal
Host
Rabbit
Gene
PROS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Pros1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protein S/PROS1 Antibody

  • EC 3.4.21
  • PROS
  • PROS1
  • protein S (alpha)
  • Protein S
  • protein Sa
  • PS21
  • PS22
  • PS23
  • PS24
  • PS25
  • PSA
  • vitamin K-dependent plasma protein S
  • vitamin K-dependent protein S

Background

Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-74073
Species: Mu, Rt
Applications: WB

Publications for Protein S/PROS1 Antibody (NBP1-74073) (0)

There are no publications for Protein S/PROS1 Antibody (NBP1-74073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein S/PROS1 Antibody (NBP1-74073) (0)

There are no reviews for Protein S/PROS1 Antibody (NBP1-74073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein S/PROS1 Antibody (NBP1-74073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein S/PROS1 Products

Bioinformatics Tool for Protein S/PROS1 Antibody (NBP1-74073)

Discover related pathways, diseases and genes to Protein S/PROS1 Antibody (NBP1-74073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein S/PROS1 Antibody (NBP1-74073)

Discover more about diseases related to Protein S/PROS1 Antibody (NBP1-74073).
 

Pathways for Protein S/PROS1 Antibody (NBP1-74073)

View related products by pathway.

PTMs for Protein S/PROS1 Antibody (NBP1-74073)

Learn more about PTMs related to Protein S/PROS1 Antibody (NBP1-74073).

Blogs on Protein S/PROS1

There are no specific blogs for Protein S/PROS1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein S/PROS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PROS1
Entrez
Uniprot