Recombinant Human Protein Kinase D2 Protein

Images

 
There are currently no images for Protein Kinase D2 Recombinant Protein (NBP1-99467).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE, Bioactivity
Concentration
0.1 mg/ml

Order Details

Recombinant Human Protein Kinase D2 Protein Summary

Description
Recombinant Human Protein Kinase D2

Source:Baculovirus (Sf9 insect cells)
Amino Acid Sequence:(Q9BZL6): MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

Source
Sf 9 (baculovirus)
Protein/Peptide Type
Recombinant Protein
Gene
PRKD2
Purity
>80% SDS-PAGE

Applications/Dilutions

Dilutions
  • Bioactivity
  • SDS-Page
Application Notes
Specific activity: 259 nmol phosphate incorporated into CREBtide substrate peptide (KRREILSRRPSYR) per minute per mg protein at 30C for 15 minutes using a final concentration of 50 uM ATP (0.83 uCi/assay).
Theoretical MW
130 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.25 mM DTT, 0.1 mM EGTA, 0.1 mM EDTA, 0.1 mM PMSF, 25% glycerol
Concentration
0.1 mg/ml
Purity
>80% SDS-PAGE

Alternate Names for Recombinant Human Protein Kinase D2 Protein

  • DKFZP586E0820
  • EC 2.7.11
  • EC 2.7.11.13
  • nPKC-D2
  • PKD2
  • PKD2HSPC187
  • PRKD2
  • protein kinase D2
  • serine/threonine-protein kinase D2

Background

PKD2 is a novel phorbol ester- and growth factor-stimulated serine/threonine kinase that contains two cysteine-rich motifs at the N terminus, a pleckstrin homology domain, and a catalytic domain (1). It exhibits the strongest homology to the serine/threonine protein kinases PKD/PKCmu and PKCnu, particularly in the duplex zinc finger-like cysteine-rich motif, in the pleckstrin homology domain and in the protein kinase domain. The PKD family of enzymes have been implicated in very diverse cellular functions, including Golgi organization and plasma membrane directed transport, metastasis, immune responses, apoptosis and cell proliferation (2).PKD2 can be activated by phorbol esters both in vivo and in vitro but also by gastrin via the cholecystokinin/CCK(B) receptor in human gastric cancer cells stably transfected with the CCK(B)/gastrin receptor (AGS-B cells) (3). Gastrin-stimulated PKD2 activation involves a heterotrimeric Galpha(q) protein as well as the activation of phospholipase C. Furthermore, PKD2 can be activated by classical and novel members of the protein kinase C (PKC) family such as PKCalpha, PKC epsilon, and PKC eta implicating PKD2 to be a downstream target of specific PKCs upon the stimulation of AGS-B cells with gastrin . PKD2 is predominantly cytoplasmic and stimulation of cells with the G protein-coupled receptor agonist neurotensin induces a rapid and reversible plasma membrane translocation of PKD2 by a mechanism that requires PKC activity (4). In contrast to the other PKD isoenzymes, PKD2 activation does not induce its redistribution from the cytoplasm to the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
BC110-60479
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-87948
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP2-38536
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14924
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00009033-M01
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-99467
Species: Hu
Applications: PAGE, Bioactivity

Publications for Protein Kinase D2 Recombinant Protein (NBP1-99467) (0)

There are no publications for Protein Kinase D2 Recombinant Protein (NBP1-99467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Kinase D2 Recombinant Protein (NBP1-99467) (0)

There are no reviews for Protein Kinase D2 Recombinant Protein (NBP1-99467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein Kinase D2 Recombinant Protein (NBP1-99467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protein Kinase D2 Products

Bioinformatics Tool for Protein Kinase D2 Recombinant Protein (NBP1-99467)

Discover related pathways, diseases and genes to Protein Kinase D2 Recombinant Protein (NBP1-99467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein Kinase D2 Recombinant Protein (NBP1-99467)

Discover more about diseases related to Protein Kinase D2 Recombinant Protein (NBP1-99467).
 

Pathways for Protein Kinase D2 Recombinant Protein (NBP1-99467)

View related products by pathway.

PTMs for Protein Kinase D2 Recombinant Protein (NBP1-99467)

Learn more about PTMs related to Protein Kinase D2 Recombinant Protein (NBP1-99467).
 

Research Areas for Protein Kinase D2 Recombinant Protein (NBP1-99467)

Find related products by research area.

Blogs on Protein Kinase D2

There are no specific blogs for Protein Kinase D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protein Kinase D2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKD2