Proteasome 20S C2 Antibody

Images

 
Western Blot: Proteasome 20S C2 Antibody [NBP1-57299] - Human non-small cell lung cancer (NCI-460)Primary Dilution: 1:2000Secondary Dilution: 1:300050kDa band is a tubulin loading control band.
Immunocytochemistry/ Immunofluorescence: Proteasome 20S C2 Antibody [NBP1-57299] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic
Western Blot: Proteasome 20S C2 Antibody [NBP1-57299] - NCI-H460, Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Product Discontinued
View other related Proteasome 20S C2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57299
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Proteasome 20S C2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PSMA1(proteasome (prosome, macropain) subunit, alpha type, 1) The peptide sequence was selected from the C terminal of PSMA1. Peptide sequence TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL.
Specificity
This product is specific to Subunit or Isofrom: alpha type-1.
Clonality
Polyclonal
Host
Rabbit
Gene
PSMA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PSMA1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Proteasome 20S C2 Antibody

  • EC 3.4.25.1
  • HC2Proteasome nu chain
  • Macropain subunit C2
  • macropain subunit nu
  • MGC14542
  • MGC14575
  • MGC14751
  • MGC1667
  • MGC21459
  • MGC22853
  • MGC23915
  • Multicatalytic endopeptidase complex subunit C2
  • NU30 kDa prosomal protein
  • PROS-30
  • PROS30Proteasome component C2
  • proteasome (prosome, macropain) subunit, alpha type, 1
  • proteasome subunit alpha type-1
  • proteasome subunit nu
  • proteasome subunit, alpha-type, 1
  • protein P30-33K
  • PSC2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6240
Species: Hu
Applications: WB, IHC
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA

Publications for Proteasome 20S C2 Antibody (NBP1-57299) (0)

There are no publications for Proteasome 20S C2 Antibody (NBP1-57299).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S C2 Antibody (NBP1-57299) (0)

There are no reviews for Proteasome 20S C2 Antibody (NBP1-57299). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S C2 Antibody (NBP1-57299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 20S C2 Products

Bioinformatics Tool for Proteasome 20S C2 Antibody (NBP1-57299)

Discover related pathways, diseases and genes to Proteasome 20S C2 Antibody (NBP1-57299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S C2 Antibody (NBP1-57299)

Discover more about diseases related to Proteasome 20S C2 Antibody (NBP1-57299).
 

Pathways for Proteasome 20S C2 Antibody (NBP1-57299)

View related products by pathway.

PTMs for Proteasome 20S C2 Antibody (NBP1-57299)

Learn more about PTMs related to Proteasome 20S C2 Antibody (NBP1-57299).
 

Research Areas for Proteasome 20S C2 Antibody (NBP1-57299)

Find related products by research area.

Blogs on Proteasome 20S C2

There are no specific blogs for Proteasome 20S C2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 20S C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA1
Uniprot