Proteasome 20S beta 7 Antibody

Images

 
Western Blot: Proteasome 20S beta 7 Antibody [H00005695-B01P] - Analysis of PSMB7 expression in transfected 293T cell line by PSMB7 polyclonal antibody. Lane 1: PSMB7 transfected lysate(30.47 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta 7 Antibody [H00005695-B01P] - Analysis of purified antibody to PSMB7 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Proteasome 20S beta 7 Antibody Summary

Immunogen
PSMB7 (NP_002790.1, 1 a.a. - 277 a.a.) full-length human protein. MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PSMB7
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Proteasome 20S beta 7 Antibody

  • EC 3.4.25.1
  • Macropain chain Z
  • Multicatalytic endopeptidase complex chain Z
  • proteasome (prosome, macropain) subunit, beta type, 7
  • proteasome subunit alpha
  • proteasome subunit beta 7
  • proteasome subunit beta type-7
  • Proteasome subunit Z
  • PSMB7
  • Zproteasome catalytic subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005694-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34158
Species: Hu
Applications: IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00005695-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for Proteasome 20S beta 7 Antibody (H00005695-B01P) (0)

There are no publications for Proteasome 20S beta 7 Antibody (H00005695-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta 7 Antibody (H00005695-B01P) (0)

There are no reviews for Proteasome 20S beta 7 Antibody (H00005695-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S beta 7 Antibody (H00005695-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 20S beta 7 Products

Bioinformatics Tool for Proteasome 20S beta 7 Antibody (H00005695-B01P)

Discover related pathways, diseases and genes to Proteasome 20S beta 7 Antibody (H00005695-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta 7 Antibody (H00005695-B01P)

Discover more about diseases related to Proteasome 20S beta 7 Antibody (H00005695-B01P).
 

Pathways for Proteasome 20S beta 7 Antibody (H00005695-B01P)

View related products by pathway.

Blogs on Proteasome 20S beta 7

There are no specific blogs for Proteasome 20S beta 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 20S beta 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB7
Uniprot