Proteasome 19S S5A Antibody


Immunocytochemistry/ Immunofluorescence: Proteasome 19S S5A Antibody [NBP1-90821] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human liver.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining in human testis and pancreas tissues using anti-PSMD4 antibody. Corresponding PSMD4 RNA-seq data are more
Independent Antibodies: Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-PSMD4 antibody NBP1-90821 (A) shows more
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human cerebral cortex.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Proteasome 19S S5A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI
Specificity of human Proteasome 19S S5A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Proteasome 19S S5A Protein (NBP1-90821PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Proteasome 19S S5A Antibody

  • 26S proteasome non-ATPase regulatory subunit 4
  • 26S proteasome regulatory subunit S5A
  • AF-1,26S protease subunit S5a
  • AFMCB1
  • angiocidin
  • Antisecretory factor 1
  • ASF
  • multiubiquitin chain binding protein
  • Multiubiquitin chain-binding protein
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
  • pUB-R5,26S proteasome regulatory subunit RPN10
  • RPN10 homolog
  • Rpn10
  • S5A
  • S5a/antisecretory factor protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Proteasome 19S S5A Antibody (NBP1-90821) (0)

There are no publications for Proteasome 19S S5A Antibody (NBP1-90821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S5A Antibody (NBP1-90821) (0)

There are no reviews for Proteasome 19S S5A Antibody (NBP1-90821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Proteasome 19S S5A Antibody (NBP1-90821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Proteasome 19S S5A Antibody (NBP1-90821)

Discover related pathways, diseases and genes to Proteasome 19S S5A Antibody (NBP1-90821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 19S S5A Antibody (NBP1-90821)

Discover more about diseases related to Proteasome 19S S5A Antibody (NBP1-90821).

Pathways for Proteasome 19S S5A Antibody (NBP1-90821)

View related products by pathway.

PTMs for Proteasome 19S S5A Antibody (NBP1-90821)

Learn more about PTMs related to Proteasome 19S S5A Antibody (NBP1-90821).

Research Areas for Proteasome 19S S5A Antibody (NBP1-90821)

Find related products by research area.

Blogs on Proteasome 19S S5A

There are no specific blogs for Proteasome 19S S5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proteasome 19S S5A Antibody and receive a gift card or discount.


Gene Symbol PSMD4