Protease Inhibitor 15 Antibody

Images

 
Western Blot: Protease Inhibitor 15 Antibody [NBP1-74087] - Human Fetal Heart Lysate, concentration 1 ug/ml.
Western Blot: Protease Inhibitor 15 Antibody [NBP1-74087] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related Protease Inhibitor 15 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74087
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Protease Inhibitor 15 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of PI15. Immunizing peptide sequence PPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKV.
Clonality
Polyclonal
Host
Rabbit
Gene
PI15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PI15 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protease Inhibitor 15 Antibody

  • 25 kDa trypsin inhibitor
  • CRISP8
  • CRISP-8
  • Cysteine-rich secretory protein 8
  • P24TI
  • p25TI
  • P25TIDKFZp686F0366
  • peptidase inhibitor 15
  • PI-15
  • protease inhibitor 15
  • sugarCrisp

Background

This gene encodes a trypsin inhibitor. The protein shares similarity to insect venom allergens, mammalian testis-specific proteins and plant pathogenesis-related proteins. It is frequently expressed in human neuroblastoma and glioblastoma cell lines, and thus may play a role in the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4929
Species: Mu
Applications: WB
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-84413
Species: Hu
Applications: IHC, IHC-P
NBP2-47126
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4468
Species: Mu
Applications: WB
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-85143
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-74087
Species: Hu
Applications: WB

Publications for Protease Inhibitor 15 Antibody (NBP1-74087) (0)

There are no publications for Protease Inhibitor 15 Antibody (NBP1-74087).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protease Inhibitor 15 Antibody (NBP1-74087) (0)

There are no reviews for Protease Inhibitor 15 Antibody (NBP1-74087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protease Inhibitor 15 Antibody (NBP1-74087) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protease Inhibitor 15 Products

Bioinformatics Tool for Protease Inhibitor 15 Antibody (NBP1-74087)

Discover related pathways, diseases and genes to Protease Inhibitor 15 Antibody (NBP1-74087). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protease Inhibitor 15 Antibody (NBP1-74087)

Discover more about diseases related to Protease Inhibitor 15 Antibody (NBP1-74087).
 

Pathways for Protease Inhibitor 15 Antibody (NBP1-74087)

View related products by pathway.

Research Areas for Protease Inhibitor 15 Antibody (NBP1-74087)

Find related products by research area.

Blogs on Protease Inhibitor 15

There are no specific blogs for Protease Inhibitor 15, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protease Inhibitor 15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PI15
Uniprot