Recombinant Human Prolactin R Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Prolactin R Peptides and Proteins

Order Details


    • Catalog Number
      H00005618-P02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Prolactin R Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-622 of Human PRLR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
PRLR

Applications/Dilutions

Application Notes
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 1 Review rated 3
using
H00005618-P02 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Prolactin R Protein

  • delta 4-delta 7/11 truncated prolactin receptor
  • delta 4-SF1b truncated prolactin receptor
  • hPRL receptor
  • hPRLrI
  • PRLR
  • PRL-R
  • Prolactin R
  • prolactin receptor delta 7/11
  • prolactin receptor
  • ProlactinR
  • secreted prolactin binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1360
Species: Mu
Applications: WB, IHC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2720
Species: Hu
Applications: WB, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56637
Species: Hu, Mu
Applications: WB

Publications for Prolactin R Recombinant Protein (H00005618-P02) (0)

There are no publications for Prolactin R Recombinant Protein (H00005618-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Prolactin R Recombinant Protein (H00005618-P02) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00005618-P02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
sean taheri
WB Human 05/26/2010
View

Summary

ApplicationWestern Blot
Sample TestedORLR recombinant protein, Sample Amount:.2 ug
SpeciesHuman
Commentsbands were seen at expected size

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in TBST, Blocking Time: 2 hours, Blocking Temp: 4 degrees Celsius

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: 5% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: ab6721, Secondary Ab Dilution Ratio: 1:1000
Secondary Manufacturer Cat#ab6721

Details

Detection NotesMethod:Chemiluminescence, Exposure Time:10 min, Pos.Ctrl:MCF-7 whole cell lysate, Bands:100kDa(specific), 60kDa(non-specific)

Comments

Commentsbands were seen at expected size

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prolactin R Recombinant Protein (H00005618-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Prolactin R Products

Bioinformatics Tool for Prolactin R Recombinant Protein (H00005618-P02)

Discover related pathways, diseases and genes to Prolactin R Recombinant Protein (H00005618-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolactin R Recombinant Protein (H00005618-P02)

Discover more about diseases related to Prolactin R Recombinant Protein (H00005618-P02).
 

Pathways for Prolactin R Recombinant Protein (H00005618-P02)

View related products by pathway.

PTMs for Prolactin R Recombinant Protein (H00005618-P02)

Learn more about PTMs related to Prolactin R Recombinant Protein (H00005618-P02).
 

Research Areas for Prolactin R Recombinant Protein (H00005618-P02)

Find related products by research area.

Blogs on Prolactin R

There are no specific blogs for Prolactin R, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
sean taheri
05/26/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol PRLR
Entrez