Prolactin R Antibody

Images

 
Western Blot: Prolactin R Antibody [H00005618-D01P] - Analysis of PRLR expression in A-431.
Western Blot: Prolactin R Antibody [H00005618-D01P] - Analysis of PRLR expression in transfected 293T cell line by PRLR polyclonal antibody.Lane 1: PRLR transfected lysate(69.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prolactin R Antibody Summary

Immunogen
PRLR (NP_000940.1, 1 a.a. - 622 a.a.) full-length human protein. MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Specificity
Reacts with prolactin receptor.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRLR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.
Publications
Read Publication using H00005618-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Prolactin R Antibody

  • delta 4-delta 7/11 truncated prolactin receptor
  • delta 4-SF1b truncated prolactin receptor
  • hPRL receptor
  • hPRLrI
  • PRLR
  • PRL-R
  • Prolactin R
  • prolactin receptor delta 7/11
  • prolactin receptor
  • ProlactinR
  • secreted prolactin binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1360
Species: Mu
Applications: WB, IHC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2720
Species: Hu
Applications: WB, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56637
Species: Hu, Mu
Applications: WB

Publications for Prolactin R Antibody (H00005618-D01P)(1)


Reviews for Prolactin R Antibody (H00005618-D01P) (0)

There are no reviews for Prolactin R Antibody (H00005618-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prolactin R Antibody (H00005618-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prolactin R Products

Bioinformatics Tool for Prolactin R Antibody (H00005618-D01P)

Discover related pathways, diseases and genes to Prolactin R Antibody (H00005618-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolactin R Antibody (H00005618-D01P)

Discover more about diseases related to Prolactin R Antibody (H00005618-D01P).
 

Pathways for Prolactin R Antibody (H00005618-D01P)

View related products by pathway.

PTMs for Prolactin R Antibody (H00005618-D01P)

Learn more about PTMs related to Prolactin R Antibody (H00005618-D01P).
 

Research Areas for Prolactin R Antibody (H00005618-D01P)

Find related products by research area.

Blogs on Prolactin R

There are no specific blogs for Prolactin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prolactin R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRLR
Entrez
Uniprot