Prohibitin 2 Antibody

Images

 
Western Blot: Prohibitin 2 Antibody [NBP1-54671] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Immunohistochemistry: Prohibitin 2 Antibody [NBP1-54671] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: ...read more

Product Details

Summary
Product Discontinued
View other related Prohibitin 2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54671
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Prohibitin 2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PHB2(prohibitin 2) The peptide sequence was selected from the N terminal of PHB2. Peptide sequence WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR.
Predicted Species
Human (100%), Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PHB2 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Prohibitin 2 Antibody

  • BAP
  • Bap37
  • BCAP37
  • B-cell associated protein
  • D-Prohibitin
  • MGC117268
  • p22
  • PHB2
  • PNAS-141
  • Prohibitin 2
  • prohibitin-2
  • REA
  • REAB-cell receptor-associated protein BAP37
  • Repressor of estrogen receptor activity

Background

PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-13677
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP2-35212
Species: Hu
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-41012
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00138428-P01
Species: Hu
NBP1-54671
Species: Hu, Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB, IHC

Publications for Prohibitin 2 Antibody (NBP1-54671) (0)

There are no publications for Prohibitin 2 Antibody (NBP1-54671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prohibitin 2 Antibody (NBP1-54671) (0)

There are no reviews for Prohibitin 2 Antibody (NBP1-54671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prohibitin 2 Antibody (NBP1-54671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Prohibitin 2 Products

Bioinformatics Tool for Prohibitin 2 Antibody (NBP1-54671)

Discover related pathways, diseases and genes to Prohibitin 2 Antibody (NBP1-54671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prohibitin 2 Antibody (NBP1-54671)

Discover more about diseases related to Prohibitin 2 Antibody (NBP1-54671).
 

Pathways for Prohibitin 2 Antibody (NBP1-54671)

View related products by pathway.

PTMs for Prohibitin 2 Antibody (NBP1-54671)

Learn more about PTMs related to Prohibitin 2 Antibody (NBP1-54671).
 

Research Areas for Prohibitin 2 Antibody (NBP1-54671)

Find related products by research area.

Blogs on Prohibitin 2

There are no specific blogs for Prohibitin 2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prohibitin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHB2
Uniprot