Progesterone R/NR3C3 Antibody (2C2)

Images

 
Western Blot: Progesterone R/NR3C3 Antibody (2C2) [H00005241-M04] - Analysis of PGR expression in A-431 (Cat # L015V1).
Immunocytochemistry/ Immunofluorescence: Progesterone R/NR3C3 Antibody (2C2) [H00005241-M04] - Analysis of monoclonal antibody to PGR on A-431 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (2C2) [H00005241-M04] - Analysis of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 1.5 ug/ml
ELISA: Progesterone R/NR3C3 Antibody (2C2) [H00005241-M04] - Detection limit for recombinant GST tagged PGR is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2C2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Progesterone R/NR3C3 Antibody (2C2) Summary

Immunogen
PGR (NP_000917, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Localization
Nuclear
Specificity
PGR - progesterone receptor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PGR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Progesterone R/NR3C3 Antibody (2C2)

  • NR3C3
  • NR3C3PRNuclear receptor subfamily 3 group C member 3
  • PGR
  • Progesterone R
  • progesterone receptor
  • ProgesteroneR

Background

This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform A only, and mediate their own response genes and physiologic effects with little overlap. The location of transcription initiation for isoform B has not been clearly determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Progesterone R/NR3C3 Antibody (H00005241-M04) (0)

There are no publications for Progesterone R/NR3C3 Antibody (H00005241-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Progesterone R/NR3C3 Antibody (H00005241-M04) (0)

There are no reviews for Progesterone R/NR3C3 Antibody (H00005241-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Progesterone R/NR3C3 Antibody (H00005241-M04). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in getting antibodies for PR (progesterone receptor) that would work in flow cytometry. Could you recommend some choices?
    • We do not currently have any antibodies directed towards the progesterone receptor that have been validated in flow cytometry, but any of our antibodies that work in ICC should work just fine in flow as they are essentially the same application. Please see this link for our Progesterone Receptor antibodies validated in ICC.

Secondary Antibodies

 

Isotype Controls

Additional Progesterone R/NR3C3 Products

Bioinformatics Tool for Progesterone R/NR3C3 Antibody (H00005241-M04)

Discover related pathways, diseases and genes to Progesterone R/NR3C3 Antibody (H00005241-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Progesterone R/NR3C3 Antibody (H00005241-M04)

Discover more about diseases related to Progesterone R/NR3C3 Antibody (H00005241-M04).
 

Pathways for Progesterone R/NR3C3 Antibody (H00005241-M04)

View related products by pathway.

PTMs for Progesterone R/NR3C3 Antibody (H00005241-M04)

Learn more about PTMs related to Progesterone R/NR3C3 Antibody (H00005241-M04).
 

Research Areas for Progesterone R/NR3C3 Antibody (H00005241-M04)

Find related products by research area.

Blogs on Progesterone R/NR3C3

There are no specific blogs for Progesterone R/NR3C3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Progesterone R/NR3C3 Antibody (2C2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PGR
Entrez
OMIM
Uniprot