Profilin 1 Antibody

Images

 
Western Blot: Profilin 1 Antibody [NBP1-54979] - Titration: 0.5 ug/ml Positive Control: Human pregnant uterine muscle cells.
Western Blot: Profilin 1 Antibody [NBP1-54979] - Murine uteria tissue, concentration 0.5 ug/ml.
Western Blot: Profilin 1 Antibody [NBP1-54979] - Human pregnant uterine muscle cells, concentration 0.5 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Profilin 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PFN1(profilin 1) The peptide sequence was selected from the N terminal of PFN1. Peptide sequence AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PFN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PFN1 and was validated on Western blot.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Profilin 1 Antibody

  • PFN1
  • PROF1
  • Profilin 1
  • Profilin I
  • profilin-1

Background

PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87426
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-230
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC

Publications for Profilin 1 Antibody (NBP1-54979) (0)

There are no publications for Profilin 1 Antibody (NBP1-54979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Profilin 1 Antibody (NBP1-54979) (0)

There are no reviews for Profilin 1 Antibody (NBP1-54979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Profilin 1 Antibody (NBP1-54979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Profilin 1 Products

Bioinformatics Tool for Profilin 1 Antibody (NBP1-54979)

Discover related pathways, diseases and genes to Profilin 1 Antibody (NBP1-54979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Profilin 1 Antibody (NBP1-54979)

Discover more about diseases related to Profilin 1 Antibody (NBP1-54979).
 

Pathways for Profilin 1 Antibody (NBP1-54979)

View related products by pathway.

PTMs for Profilin 1 Antibody (NBP1-54979)

Learn more about PTMs related to Profilin 1 Antibody (NBP1-54979).
 

Research Areas for Profilin 1 Antibody (NBP1-54979)

Find related products by research area.

Blogs on Profilin 1.

Profiling the Profilin 1 Antibody
Profilin-1, or Pfn-1, is a small actin-binding protein which plays an essential role controlling the growth of microfilaments. Profilin 1 and Profilin 2 have similar biochemical properties but are expressed in different tissues. The Profilin 1 antibod...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Profilin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFN1
Entrez
Uniprot