Profilin 1 Antibody

Images

 
Western Blot: Profilin 1 Antibody [H00005216-B01P] - Analysis of PFN1 expression in transfected 293T cell line by PFN1 polyclonal antibody. Lane 1: PFN1 transfected lysate(15.51 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Profilin 1 Antibody Summary

Immunogen
PFN1 (AAH06768, 1 a.a. - 140 a.a.) full-length human protein. MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PFN1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Profilin 1 Antibody

  • PFN1
  • PROF1
  • Profilin 1
  • Profilin I
  • profilin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87426
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-230
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC

Publications for Profilin 1 Antibody (H00005216-B01P) (0)

There are no publications for Profilin 1 Antibody (H00005216-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Profilin 1 Antibody (H00005216-B01P) (0)

There are no reviews for Profilin 1 Antibody (H00005216-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Profilin 1 Antibody (H00005216-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Profilin 1 Products

Bioinformatics Tool for Profilin 1 Antibody (H00005216-B01P)

Discover related pathways, diseases and genes to Profilin 1 Antibody (H00005216-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Profilin 1 Antibody (H00005216-B01P)

Discover more about diseases related to Profilin 1 Antibody (H00005216-B01P).
 

Pathways for Profilin 1 Antibody (H00005216-B01P)

View related products by pathway.

PTMs for Profilin 1 Antibody (H00005216-B01P)

Learn more about PTMs related to Profilin 1 Antibody (H00005216-B01P).
 

Research Areas for Profilin 1 Antibody (H00005216-B01P)

Find related products by research area.

Blogs on Profilin 1.

Profiling the Profilin 1 Antibody
Profilin-1, or Pfn-1, is a small actin-binding protein which plays an essential role controlling the growth of microfilaments. Profilin 1 and Profilin 2 have similar biochemical properties but are expressed in different tissues. The Profilin 1 antibod...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Profilin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFN1
Entrez
Uniprot