Recombinant Human Proapoptotic Caspase Adaptor Protein Protein

Order Details


    • Catalog Number
      H00051237-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Proapoptotic Caspase Adaptor Protein Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-189 of Human PACAP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MZB1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Proapoptotic Caspase Adaptor Protein Protein

  • caspase-2 binding protein
  • FLJ32987
  • HSPC190
  • marginal zone B and B1 cell-specific protein
  • MGC29506
  • PACAP
  • pERp1
  • plasma cell-induced ER protein 1
  • plasma cell-induced resident endoplasmic reticulum protein
  • Plasma cell-induced resident ER protein
  • Proapoptotic caspase adapter protein
  • proapoptotic caspase adaptor protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
MAB5416
Species: Hu
Applications: IHC
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
H00051237-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01) (0)

There are no publications for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01) (0)

There are no reviews for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proapoptotic Caspase Adaptor Protein Products

Bioinformatics Tool for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01)

Discover related pathways, diseases and genes to Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01)

Discover more about diseases related to Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01).
 

Pathways for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01)

View related products by pathway.

PTMs for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01)

Learn more about PTMs related to Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01).
 

Research Areas for Proapoptotic Caspase Adaptor Protein Recombinant Protein (H00051237-P01)

Find related products by research area.

Blogs on Proapoptotic Caspase Adaptor Protein

There are no specific blogs for Proapoptotic Caspase Adaptor Protein, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Proapoptotic Caspase Adaptor Protein Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MZB1