PRNT Antibody


Immunohistochemistry-Paraffin: PRNT Antibody [NBP1-93533] - Staining of human testis shows moderate cytoplasmic and nucleolar positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PRNT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVTHSLWHLQIPVDCQACNR
Specificity of human PRNT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRNT Antibody

  • M8
  • prion protein (testis specific)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, KO
Species: Hu
Applications: WB, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P

Publications for PRNT Antibody (NBP1-93533) (0)

There are no publications for PRNT Antibody (NBP1-93533).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRNT Antibody (NBP1-93533) (0)

There are no reviews for PRNT Antibody (NBP1-93533). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRNT Antibody (NBP1-93533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PRNT Products

Array NBP1-93533

Bioinformatics Tool for PRNT Antibody (NBP1-93533)

Discover related pathways, diseases and genes to PRNT Antibody (NBP1-93533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRNT Antibody (NBP1-93533)

Discover more about diseases related to PRNT Antibody (NBP1-93533).

Pathways for PRNT Antibody (NBP1-93533)

View related products by pathway.

PTMs for PRNT Antibody (NBP1-93533)

Learn more about PTMs related to PRNT Antibody (NBP1-93533).

Blogs on PRNT

There are no specific blogs for PRNT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRNT Antibody and receive a gift card or discount.


Gene Symbol PRNT