PRMT6 Antibody

Images

 
Western Blot: PRMT6 Antibody [NBP1-55400] - 293T cells lysate, concentration 0.2-1 ug/ml.
Chromatin Immunoprecipitation: PRMT6 Antibody [NBP1-55400] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and ...read more

Product Details

Summary
Product Discontinued
View other related PRMT6 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55400
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PRMT6 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRMT6(protein arginine methyltransferase 6) The peptide sequence was selected from the middle region of PRMT6. Peptide sequence FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY.
Specificity
3
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRMT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Chromatin Immunoprecipitation
Application Notes
This is a rabbit polyclonal antibody against PRMT6 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRMT6 Antibody

  • EC 2.1.1.-
  • EC 2.1.1.125
  • FLJ10559
  • FLJ51477
  • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6
  • Histone-arginine N-methyltransferase PRMT6
  • HMT1 hnRNP methyltransferase-like 6 (S. cerevisiae)
  • HMT1 hnRNP methyltransferase-like 6
  • HRMT1L6
  • protein arginine methyltransferase 6
  • protein arginine N-methyltransferase 6

Background

Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-342
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-64711
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
AF5810
Species: Hu, Mu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-19939
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56641
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-79286
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Ze
Applications: WB
NBP1-31470
Species: Hu, Mu, Rt, Bv, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: IHC, IHC-P

Publications for PRMT6 Antibody (NBP1-55400) (0)

There are no publications for PRMT6 Antibody (NBP1-55400).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRMT6 Antibody (NBP1-55400) (0)

There are no reviews for PRMT6 Antibody (NBP1-55400). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Webinar
ChIP Video Protocol

FAQs for PRMT6 Antibody (NBP1-55400) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PRMT6 Products

Bioinformatics Tool for PRMT6 Antibody (NBP1-55400)

Discover related pathways, diseases and genes to PRMT6 Antibody (NBP1-55400). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT6 Antibody (NBP1-55400)

Discover more about diseases related to PRMT6 Antibody (NBP1-55400).
 

Pathways for PRMT6 Antibody (NBP1-55400)

View related products by pathway.

PTMs for PRMT6 Antibody (NBP1-55400)

Learn more about PTMs related to PRMT6 Antibody (NBP1-55400).
 

Research Areas for PRMT6 Antibody (NBP1-55400)

Find related products by research area.

Blogs on PRMT6.

PRMT6: One Function, Many Roles
Protein arginine methylation is a prevalent posttranslational modification in eukaryotic cells. It regulates RNA processing, trafficking and nascent pre-RNA metabolism, receptor-mediated signal transduction, and transcriptional activation processes. P...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRMT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRMT6
Uniprot