PRMT2 Antibody

Images

 
Western Blot: PRMT2 Antibody [NBP1-53004] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PRMT2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53004
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PRMT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRMT2(protein arginine methyltransferase 2) The peptide sequence was selected from the middle region of PRMT2. Peptide sequence VHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIW.
Clonality
Polyclonal
Host
Rabbit
Gene
PRMT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRMT2 and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRMT2 Antibody

  • EC 2.1.1.-
  • EC 2.1.1.125
  • Histone-arginine N-methyltransferase PRMT2
  • HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1
  • HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae)
  • HMT1 hnRNP methyltransferase-like 1
  • HMT1
  • HRMT1L1PRMT2 beta
  • MGC111373
  • PRMT2 alpha
  • PRMT2 gamma
  • protein arginine methyltransferase 2
  • protein arginine N-methyltransferase 2

Background

The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-342
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004675-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-83205
Species: Hu
Applications: WB, IHC, IHC-P
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for PRMT2 Antibody (NBP1-53004) (0)

There are no publications for PRMT2 Antibody (NBP1-53004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRMT2 Antibody (NBP1-53004) (0)

There are no reviews for PRMT2 Antibody (NBP1-53004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRMT2 Antibody (NBP1-53004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRMT2 Products

Bioinformatics Tool for PRMT2 Antibody (NBP1-53004)

Discover related pathways, diseases and genes to PRMT2 Antibody (NBP1-53004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT2 Antibody (NBP1-53004)

Discover more about diseases related to PRMT2 Antibody (NBP1-53004).
 

Pathways for PRMT2 Antibody (NBP1-53004)

View related products by pathway.

PTMs for PRMT2 Antibody (NBP1-53004)

Learn more about PTMs related to PRMT2 Antibody (NBP1-53004).
 

Research Areas for PRMT2 Antibody (NBP1-53004)

Find related products by research area.

Blogs on PRMT2

There are no specific blogs for PRMT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRMT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRMT2
Uniprot