PRL8A9 Antibody

Images

 
Western Blot: PRL8A9 Antibody [NBP3-10215] - Western blot analysis of PRL8A9 in Mouse Kidney lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRL8A9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse PRL8A9 (NP_001303650.1). Peptide sequence ELNVMQDVPETILSKVRQIEENKRKLLEDLRWILTKVYPTAEMKEEFPAW
Clonality
Polyclonal
Host
Rabbit
Gene
Prl8a9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-16019
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46376
Species: Hu
Applications: IHC, WB

Publications for PRL8A9 Antibody (NBP3-10215) (0)

There are no publications for PRL8A9 Antibody (NBP3-10215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRL8A9 Antibody (NBP3-10215) (0)

There are no reviews for PRL8A9 Antibody (NBP3-10215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRL8A9 Antibody (NBP3-10215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRL8A9 Products

Array NBP3-10215

Bioinformatics Tool for PRL8A9 Antibody (NBP3-10215)

Discover related pathways, diseases and genes to PRL8A9 Antibody (NBP3-10215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRL8A9

There are no specific blogs for PRL8A9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRL8A9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Prl8a9