Prion protein Antibody


Immunohistochemistry-Paraffin: Prion protein Antibody [NBP1-92285] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: Prion protein Antibody [NBP1-92285] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Prion protein Antibody [NBP1-92285] - Staining in human cerebral cortex and tonsil tissues using anti-PRNP antibody. Corresponding PRNP RNA-seq data are more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Prion protein Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE
Specificity of human Prion protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prion protein Protein (NBP1-92285PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Prion protein Antibody

  • CD230
  • CJD
  • fatal familial insomnia)
  • GSS
  • prion protein (p27-30)
  • prion protein PrP
  • prion protein
  • prion-related protein
  • PRIPMGC26679


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Prion protein Antibody (NBP1-92285) (0)

There are no publications for Prion protein Antibody (NBP1-92285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prion protein Antibody (NBP1-92285) (0)

There are no reviews for Prion protein Antibody (NBP1-92285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prion protein Antibody (NBP1-92285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Prion protein Antibody (NBP1-92285)

Discover related pathways, diseases and genes to Prion protein Antibody (NBP1-92285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prion protein Antibody (NBP1-92285)

Discover more about diseases related to Prion protein Antibody (NBP1-92285).

Pathways for Prion protein Antibody (NBP1-92285)

View related products by pathway.

PTMs for Prion protein Antibody (NBP1-92285)

Learn more about PTMs related to Prion protein Antibody (NBP1-92285).

Research Areas for Prion protein Antibody (NBP1-92285)

Find related products by research area.

Blogs on Prion protein

There are no specific blogs for Prion protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Prion protein Antibody and receive a gift card or discount.


Gene Symbol PRNP