Prion protein Antibody

Images

 
Immunohistochemistry-Paraffin: Prion protein Antibody [NBP1-92285] - Staining of human lateral ventricle shows distinct cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prion protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRNP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
Prion protein Protein (NBP1-92285PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prion protein Antibody

  • CD230
  • CJD
  • fatal familial insomnia)
  • GSS
  • prion protein (p27-30)
  • prion protein PrP
  • prion protein
  • prion-related protein
  • PRIPMGC26679

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33137
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Prion protein Antibody (NBP1-92285) (0)

There are no publications for Prion protein Antibody (NBP1-92285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prion protein Antibody (NBP1-92285) (0)

There are no reviews for Prion protein Antibody (NBP1-92285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prion protein Antibody (NBP1-92285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prion protein Products

Bioinformatics Tool for Prion protein Antibody (NBP1-92285)

Discover related pathways, diseases and genes to Prion protein Antibody (NBP1-92285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prion protein Antibody (NBP1-92285)

Discover more about diseases related to Prion protein Antibody (NBP1-92285).
 

Pathways for Prion protein Antibody (NBP1-92285)

View related products by pathway.

PTMs for Prion protein Antibody (NBP1-92285)

Learn more about PTMs related to Prion protein Antibody (NBP1-92285).
 

Research Areas for Prion protein Antibody (NBP1-92285)

Find related products by research area.

Blogs on Prion protein

There are no specific blogs for Prion protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prion protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRNP