Presenilin-1 Antibody

Images

 
Western Blot: Presenilin-1 Antibody [NBP1-59368] - OVCAR-3 cell lysate, Antibody Titration: 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: Presenilin-1 Antibody [NBP1-59368] - Human Brain, cerebellum tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Product Discontinued
View other related Presenilin-1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59368
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Presenilin-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PSEN1(presenilin 1) The peptide sequence was selected from the N terminal of PSEN1. Peptide sequence TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY.
Clonality
Polyclonal
Host
Rabbit
Gene
PSEN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PSEN1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Presenilin-1 Antibody

  • AD3EC 3.4.23.-
  • Alzheimer disease 3
  • EC 3.4.23
  • FAD
  • presenilin 1
  • Presenilin1
  • Presenilin-1
  • Protein S182
  • PS-1
  • PS1presenilin-1
  • PSEN1
  • PSNL1
  • S182

Background

Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24611
Species: Hu, Mu, Rt, Bv, Ca, Eq, Op
Applications: WB
NBP1-77270
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59368
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Presenilin-1 Antibody (NBP1-59368) (0)

There are no publications for Presenilin-1 Antibody (NBP1-59368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Presenilin-1 Antibody (NBP1-59368) (0)

There are no reviews for Presenilin-1 Antibody (NBP1-59368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Presenilin-1 Antibody (NBP1-59368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Presenilin-1 Products

Bioinformatics Tool for Presenilin-1 Antibody (NBP1-59368)

Discover related pathways, diseases and genes to Presenilin-1 Antibody (NBP1-59368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Presenilin-1 Antibody (NBP1-59368)

Discover more about diseases related to Presenilin-1 Antibody (NBP1-59368).
 

Pathways for Presenilin-1 Antibody (NBP1-59368)

View related products by pathway.

PTMs for Presenilin-1 Antibody (NBP1-59368)

Learn more about PTMs related to Presenilin-1 Antibody (NBP1-59368).
 

Research Areas for Presenilin-1 Antibody (NBP1-59368)

Find related products by research area.

Blogs on Presenilin-1

There are no specific blogs for Presenilin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Presenilin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSEN1
Entrez
Uniprot