PPWD1 Antibody

Images

 
Western Blot: PPWD1 Antibody [NBP1-56780] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PPWD1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56780
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PPWD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PPWD1(peptidylprolyl isomerase domain and WD repeat containing 1) The peptide sequence was selected from the middle region of PPWD1. Peptide sequence FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG.
Clonality
Polyclonal
Host
Rabbit
Gene
PPWD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PPWD1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPWD1 Antibody

  • EC 5.2.1.8
  • KIAA0073Spliceosome-associated cyclophilin
  • peptidylprolyl isomerase domain and WD repeat containing 1
  • peptidylprolyl isomerase domain and WD repeat-containing protein 1

Background

PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84472
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for PPWD1 Antibody (NBP1-56780) (0)

There are no publications for PPWD1 Antibody (NBP1-56780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPWD1 Antibody (NBP1-56780) (0)

There are no reviews for PPWD1 Antibody (NBP1-56780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPWD1 Antibody (NBP1-56780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPWD1 Products

Bioinformatics Tool for PPWD1 Antibody (NBP1-56780)

Discover related pathways, diseases and genes to PPWD1 Antibody (NBP1-56780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPWD1 Antibody (NBP1-56780)

Discover more about diseases related to PPWD1 Antibody (NBP1-56780).
 

Pathways for PPWD1 Antibody (NBP1-56780)

View related products by pathway.

Blogs on PPWD1

There are no specific blogs for PPWD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPWD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPWD1
Uniprot