PPP4C Antibody

Images

 
Western Blot: PPP4C Antibody [NBP2-13802] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PPP4C Antibody [NBP2-13802] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PPP4C Antibody [NBP2-13802] - Staining of human nasopharynx shows strong nuclear and cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP4C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVT VCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP4C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
PPP4C Protein (NBP2-13802PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP4C Antibody

  • EC 3.1.3.16
  • Pp4
  • PP4C
  • PP4protein phosphatase X, catalytic subunit
  • PPP4
  • PP-X
  • PPXPPH3
  • protein phosphatase 4 (formerly X), catalytic subunit
  • protein phosphatase 4, catalytic subunit
  • Protein phosphatase X
  • serine/threonine-protein phosphatase 4 catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2883
Species: Hu, Mu
Applications: WB, IP
NBP1-80898
Species: Hu
Applications: WB, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-2877
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-83882
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87241
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP4C Antibody (NBP2-13802) (0)

There are no publications for PPP4C Antibody (NBP2-13802).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP4C Antibody (NBP2-13802) (0)

There are no reviews for PPP4C Antibody (NBP2-13802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP4C Antibody (NBP2-13802). (Showing 1 - 1 of 1 FAQ).

  1. The antibody I am looking for is the anti-mouse PP4C. We have been using an old antibody from your company (Rabbit polyclonal to PPP4C, catalog # NB100-2874), which I assume is discontinued, as I could not find it on your website. As I have mentioned to you, I am looking for PP4C (anti-mouse) antibodies for IP and IHC. I appreciate it if you can inform me of any of your antibody products suitable for these applications, and available at an affordable trial size.
    • NB110-40495 is an anti-PPP4C antibody that has been validated in Western blot, ICC, IHC on paraffin-embedded tissues and immunoprecipitation on human and mouse samples.

Secondary Antibodies

 

Isotype Controls

Additional PPP4C Products

Bioinformatics Tool for PPP4C Antibody (NBP2-13802)

Discover related pathways, diseases and genes to PPP4C Antibody (NBP2-13802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP4C Antibody (NBP2-13802)

Discover more about diseases related to PPP4C Antibody (NBP2-13802).
 

Pathways for PPP4C Antibody (NBP2-13802)

View related products by pathway.

Research Areas for PPP4C Antibody (NBP2-13802)

Find related products by research area.

Blogs on PPP4C

There are no specific blogs for PPP4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP4C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP4C