PPP4C Antibody


Western Blot: PPP4C Antibody [NBP1-55248] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related PPP4C Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PPP4C Antibody Summary

Synthetic peptides corresponding to PPP4C(protein phosphatase 4 (formerly X), catalytic subunit) The peptide sequence was selected from the middle region of PPP4C. Peptide sequence TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PPP4C and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP4C Antibody

  • EC
  • Pp4
  • PP4C
  • PP4protein phosphatase X, catalytic subunit
  • PPP4
  • PP-X
  • protein phosphatase 4 (formerly X), catalytic subunit
  • protein phosphatase 4, catalytic subunit
  • Protein phosphatase X
  • serine/threonine-protein phosphatase 4 catalytic subunit


PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on Ser-140 (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair. Dephosphorylates NDEL1 at CDC2/Cdk1 phosphorylation sites and negatively regulates CDC2/Cdk1 activity in interphase.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for PPP4C Antibody (NBP1-55248) (0)

There are no publications for PPP4C Antibody (NBP1-55248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP4C Antibody (NBP1-55248) (0)

There are no reviews for PPP4C Antibody (NBP1-55248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP4C Antibody (NBP1-55248). (Showing 1 - 1 of 1 FAQ).

  1. The antibody I am looking for is the anti-mouse PP4C. We have been using an old antibody from your company (Rabbit polyclonal to PPP4C, catalog # NB100-2874), which I assume is discontinued, as I could not find it on your website. As I have mentioned to you, I am looking for PP4C (anti-mouse) antibodies for IP and IHC. I appreciate it if you can inform me of any of your antibody products suitable for these applications, and available at an affordable trial size.
    • NB110-40495 is an anti-PPP4C antibody that has been validated in Western blot, ICC, IHC on paraffin-embedded tissues and immunoprecipitation on human and mouse samples.

Secondary Antibodies


Isotype Controls

Additional PPP4C Products

Bioinformatics Tool for PPP4C Antibody (NBP1-55248)

Discover related pathways, diseases and genes to PPP4C Antibody (NBP1-55248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP4C Antibody (NBP1-55248)

Discover more about diseases related to PPP4C Antibody (NBP1-55248).

Pathways for PPP4C Antibody (NBP1-55248)

View related products by pathway.

Research Areas for PPP4C Antibody (NBP1-55248)

Find related products by research area.

Blogs on PPP4C

There are no specific blogs for PPP4C, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP4C Antibody and receive a gift card or discount.


Gene Symbol PPP4C