PPP1R1C Antibody

Images

 
Immunohistochemistry: PPP1R1C Antibody [NBP2-30497] - Staining of human small intestine shows strong positivity in paneth cells.

Product Details

Summary
Product Discontinued
View other related PPP1R1C Primary Antibodies

Order Details


    • Catalog Number
      NBP2-30497
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PPP1R1C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP1R1C Antibody

  • Inhibitor-1-like
  • inhibitor-5 of protein phosphatase 1
  • IPP5
  • PP1 inhibitor protein 5
  • protein phosphatase 1 regulatory subunit 1A
  • protein phosphatase 1 regulatory subunit 1C
  • protein phosphatase 1, regulatory (inhibitor) subunit 1C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90096
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB110-62091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15649
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-30497
Species: Hu
Applications: IHC, IHC-P

Publications for PPP1R1C Antibody (NBP2-30497) (0)

There are no publications for PPP1R1C Antibody (NBP2-30497).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R1C Antibody (NBP2-30497) (0)

There are no reviews for PPP1R1C Antibody (NBP2-30497). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPP1R1C Antibody (NBP2-30497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP1R1C Products

Bioinformatics Tool for PPP1R1C Antibody (NBP2-30497)

Discover related pathways, diseases and genes to PPP1R1C Antibody (NBP2-30497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R1C Antibody (NBP2-30497)

Discover more about diseases related to PPP1R1C Antibody (NBP2-30497).
 

Pathways for PPP1R1C Antibody (NBP2-30497)

View related products by pathway.

PTMs for PPP1R1C Antibody (NBP2-30497)

Learn more about PTMs related to PPP1R1C Antibody (NBP2-30497).
 

Research Areas for PPP1R1C Antibody (NBP2-30497)

Find related products by research area.

Blogs on PPP1R1C

There are no specific blogs for PPP1R1C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP1R1C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R1C
Uniprot