PPOX Antibody (2B7)

Images

 
ELISA: PPOX Antibody (2B7) [H00005498-M09] - Detection limit for recombinant GST tagged PPOX is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related PPOX Primary Antibodies

Order Details


    • Catalog Number
      H00005498-M09
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PPOX Antibody (2B7) Summary

Immunogen
PPOX (AAH02357 378 a.a. - 477 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Specificity
PPOX - protoporphyrinogen oxidase (2B7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPOX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPOX Antibody (2B7)

  • EC 1.3.3.4
  • MGC8485
  • PPOVP
  • protoporphyrinogen oxidase
  • V290M
  • variegate porphyria

Background

This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
9134-TN
Species: Hu
NBP1-90814
Species: Hu
Applications: IHC, IHC-P

Publications for PPOX Antibody (H00005498-M09) (0)

There are no publications for PPOX Antibody (H00005498-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPOX Antibody (H00005498-M09) (0)

There are no reviews for PPOX Antibody (H00005498-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPOX Antibody (H00005498-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPOX Products

Bioinformatics Tool for PPOX Antibody (H00005498-M09)

Discover related pathways, diseases and genes to PPOX Antibody (H00005498-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPOX Antibody (H00005498-M09)

Discover more about diseases related to PPOX Antibody (H00005498-M09).
 

Pathways for PPOX Antibody (H00005498-M09)

View related products by pathway.

PTMs for PPOX Antibody (H00005498-M09)

Learn more about PTMs related to PPOX Antibody (H00005498-M09).
 

Research Areas for PPOX Antibody (H00005498-M09)

Find related products by research area.

Blogs on PPOX

There are no specific blogs for PPOX, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPOX Antibody (2B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPOX
Entrez
Uniprot