PPAR alpha/NR1C1 Antibody (1A8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PPAR alpha/NR1C1 Primary Antibodies

Order Details


    • Catalog Number
      H00005465-M03G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PPAR alpha/NR1C1 Antibody (1A8) [DyLight 488] Summary

Immunogen
PPARA (AAH00052, 1 a.a. - 258 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD
Specificity
PPARA - peroxisome proliferative activated receptor, alpha (1A8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPARA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPAR alpha/NR1C1 Antibody (1A8) [DyLight 488]

  • alpha
  • hPPAR
  • NR1C1
  • NR1C1MGC2237
  • Nuclear receptor subfamily 1 group C member 1
  • peroxisome proliferator-activated receptor alpha
  • PPAR alpha
  • PPARA
  • PPARalpha
  • PPAR-alpha
  • PPARMGC2452

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-637
Species: Hu, Mu, Rt, Ge
Applications: WB, ELISA, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for PPAR alpha/NR1C1 Antibody (H00005465-M03G) (0)

There are no publications for PPAR alpha/NR1C1 Antibody (H00005465-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAR alpha/NR1C1 Antibody (H00005465-M03G) (0)

There are no reviews for PPAR alpha/NR1C1 Antibody (H00005465-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PPAR alpha/NR1C1 Antibody (H00005465-M03G). (Showing 1 - 1 of 1 FAQ).

  1. Please differentiate me between PPAR and PGC clearly.i am confuse to know the differ these two. waiting for your reply
    • Thank you very much for contacting Novus Biologicals technical support team and sharing your query on the differences between PGC-1 alpha and PPAR. These are two different proteins encoded by their respective genes and serves different functions. PGC-1 alpha (PGC1A or PPAR gamma coactivator 1-alpha) is a transcriptional co-activator for steroid receptors and nuclear receptors, and it regulates diverse aspects of cellular physiology. It up-regulates the transcriptional activity of PPAR-gamma /thyroid hormone receptor on the uncoupling protein promoter; regulates the key mitochondrial genes involved in adaptive thermogenesis; implicates in the metabolic reprogramming in response to nutrients availability through the coordination of the expression of a wide array of genes involved in the regulation of glucose and fatty acid metabolism. Among our PGC-1 alpha antibodies, NBP1-04676 is our best selling product with nice customer feedback and citations in at least 13 research publications. PPAR (PPAR alpha) on the other hand is a ligand-activated transcription factor which gets activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine, and oleylethanolamide (a naturally occurring lipid that regulates satiety), and acts as a key regulator of lipid metabolism. It also acts as a receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. It regulates the peroxisomal beta-oxidation pathway of fatty acids, and also functions as transcription activator for the ACOX1 and P450 genes. We have a variety of PPAR alpha antibodies. I hope you will find this information helpful but please let me know if I can support you with anything else from my end. Thank you very much for choosing Novus Biologicals as your quality reagent supplier and we wish you the best with your research projects.

Secondary Antibodies

 

Isotype Controls

Additional PPAR alpha/NR1C1 Products

Bioinformatics Tool for PPAR alpha/NR1C1 Antibody (H00005465-M03G)

Discover related pathways, diseases and genes to PPAR alpha/NR1C1 Antibody (H00005465-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAR alpha/NR1C1 Antibody (H00005465-M03G)

Discover more about diseases related to PPAR alpha/NR1C1 Antibody (H00005465-M03G).
 

Pathways for PPAR alpha/NR1C1 Antibody (H00005465-M03G)

View related products by pathway.

PTMs for PPAR alpha/NR1C1 Antibody (H00005465-M03G)

Learn more about PTMs related to PPAR alpha/NR1C1 Antibody (H00005465-M03G).
 

Research Areas for PPAR alpha/NR1C1 Antibody (H00005465-M03G)

Find related products by research area.

Blogs on PPAR alpha/NR1C1

There are no specific blogs for PPAR alpha/NR1C1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAR alpha/NR1C1 Antibody (1A8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARA
Entrez