PPAN Antibody

Images

 
Immunohistochemistry: PPAN Antibody [NBP1-87465] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPAN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPAN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPAN Protein (NBP1-87465PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPAN Antibody

  • Brix domain-containing protein 3
  • homolog of S. cerevisiae SSF1
  • MGC14226
  • MGC45852
  • peter pan (Drosophila) homolog
  • peter pan homolog (Drosophila)
  • Peter Pan homolog
  • second-step splicing factor 1
  • SSF
  • Ssf-1
  • SSF1BXDC3SSF-1
  • SSF2
  • suppressor of sterile four 1
  • suppressor of SWI4 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57463
Species: Hu
Applications: WB, IHC, IHC-P
NB100-66322
Species: Hu
Applications: WB
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46376
Species: Hu
Applications: WB, IHC
AF2009
Species: Hu
Applications: WB, IHC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPAN Antibody (NBP1-87465) (0)

There are no publications for PPAN Antibody (NBP1-87465).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAN Antibody (NBP1-87465) (0)

There are no reviews for PPAN Antibody (NBP1-87465). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPAN Antibody (NBP1-87465) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPAN Products

Bioinformatics Tool for PPAN Antibody (NBP1-87465)

Discover related pathways, diseases and genes to PPAN Antibody (NBP1-87465). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAN Antibody (NBP1-87465)

Discover more about diseases related to PPAN Antibody (NBP1-87465).
 

Pathways for PPAN Antibody (NBP1-87465)

View related products by pathway.

PTMs for PPAN Antibody (NBP1-87465)

Learn more about PTMs related to PPAN Antibody (NBP1-87465).

Blogs on PPAN

There are no specific blogs for PPAN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAN