PP2D1 Antibody

Images

 
Immunohistochemistry-Paraffin: PP2D1 Antibody [NBP2-57748] - Immunohistochemical staining of human testis shows strong positivity in acrosomes in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PP2D1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PP2D1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PP2D1 Recombinant Protein Antigen (NBP2-57748PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PP2D1 Antibody

  • C3orf48
  • Chromosome 3 Open Reading Frame 48
  • Protein Phosphatase 2C-Like Domain Containing 1
  • Protein Phosphatase 2C-Like Domain-Containing Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PP2D1 Antibody (NBP2-57748) (0)

There are no publications for PP2D1 Antibody (NBP2-57748).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2D1 Antibody (NBP2-57748) (0)

There are no reviews for PP2D1 Antibody (NBP2-57748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PP2D1 Antibody (NBP2-57748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PP2D1 Products

Array NBP2-57748

Bioinformatics Tool for PP2D1 Antibody (NBP2-57748)

Discover related pathways, diseases and genes to PP2D1 Antibody (NBP2-57748). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PP2D1

There are no specific blogs for PP2D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PP2D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PP2D1