PP2D1 Antibody

Images

 
Immunohistochemistry: PP2D1 Antibody [NBP2-32675] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related PP2D1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32675
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PP2D1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LTKEHTTRNTNERRRILQNGAVISSNEPYGLVEGQVKTTRGLGFHGNLKLKKSIIPAPQTISVPIDDLCQFLIVATNGLWEVLDKEEVTALA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PP2D1 Antibody

  • C3orf48
  • Chromosome 3 Open Reading Frame 48
  • Protein Phosphatase 2C-Like Domain Containing 1
  • Protein Phosphatase 2C-Like Domain-Containing Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PP2D1 Antibody (NBP2-32675) (0)

There are no publications for PP2D1 Antibody (NBP2-32675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2D1 Antibody (NBP2-32675) (0)

There are no reviews for PP2D1 Antibody (NBP2-32675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PP2D1 Antibody (NBP2-32675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PP2D1 Antibody and receive a gift card or discount.