PP2C beta/PPM1B Antibody (1A3-2A4) [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related PP2C beta/PPM1B Primary Antibodies

Order Details


    • Catalog Number
      H00005495-M01AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PP2C beta/PPM1B Antibody (1A3-2A4) [Alexa Fluor® 700] Summary

Immunogen
PPM1B (AAH12002, 1 a.a. ~ 193 a.a) full length recombinant protein with GST tag.MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGE EGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN PHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEE MLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTE SESGLAELDSSNEDAGTKMSGEKI
Specificity
PPM1B - protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPM1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
Alexa Fluor 700
Format
Alexa Fluor 700 (A=675-700, E=723)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Proximity Ligation Assay
Application Notes
Antibody reactive against recombinant protein and transfected lysate for Western Blot. Has also been used for immunofluoresence, RNAi validation, and ELISA.

Reactivity Notes

Other species not tested.

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for PP2C beta/PPM1B Antibody (1A3-2A4) [Alexa Fluor® 700]

  • EC 3.1.3.16
  • MGC21657
  • PP2C beta/PPM1B
  • Pp2c2
  • PP2CB
  • PP2C-beta
  • PP2C-beta-X
  • PP2CBmagnesium-dependent, beta isoform
  • PPM1B
  • protein phosphatase 1B
  • Protein phosphatase 2C isoform beta
  • protein phosphatase 2C-like protein
  • protein phosphatase, Mg2+/Mn2+ dependent, 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71662
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31868
Species: Hu
Applications: IHC, IHC-P
AF3989
Species: Hu, Mu, Rt
Applications: WB
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC
NBP1-81759
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-581
Species: Hu
Applications: WB, IP, PLA
NBP1-06529
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for PP2C beta/PPM1B Antibody (H00005495-M01AF700) (0)

There are no publications for PP2C beta/PPM1B Antibody (H00005495-M01AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C beta/PPM1B Antibody (H00005495-M01AF700) (0)

There are no reviews for PP2C beta/PPM1B Antibody (H00005495-M01AF700). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP2C beta/PPM1B Antibody (H00005495-M01AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PP2C beta/PPM1B Products

Related Products by Gene

Bioinformatics Tool for PP2C beta/PPM1B Antibody (H00005495-M01AF700)

Discover related pathways, diseases and genes to PP2C beta/PPM1B Antibody (H00005495-M01AF700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C beta/PPM1B Antibody (H00005495-M01AF700)

Discover more about diseases related to PP2C beta/PPM1B Antibody (H00005495-M01AF700).
 

Pathways for PP2C beta/PPM1B Antibody (H00005495-M01AF700)

View related products by pathway.

PTMs for PP2C beta/PPM1B Antibody (H00005495-M01AF700)

Learn more about PTMs related to PP2C beta/PPM1B Antibody (H00005495-M01AF700).
 

Research Areas for PP2C beta/PPM1B Antibody (H00005495-M01AF700)

Find related products by research area.

Blogs on PP2C beta/PPM1B

There are no specific blogs for PP2C beta/PPM1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PPM1B
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00005495-M01AF700 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.