POU4F3 Antibody (5B8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related POU4F3 Primary Antibodies

Order Details


    • Catalog Number
      H00005459-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

POU4F3 Antibody (5B8) [PerCP] Summary

Immunogen
POU4F3 (NP_002691, 100 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Specificity
POU4F3 - POU domain, class 4, transcription factor 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POU4F3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POU4F3 Antibody (5B8) [PerCP]

  • brain-3C
  • Brain-specific homeobox/POU domain protein 3C
  • BRN3.1
  • Brn-3C
  • BRN3Cbrn-3C
  • DFNA15
  • MGC138412
  • POU class 4 homeobox 3
  • POU domain class 4, transcription factor 3
  • POU domain, class 4, transcription factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005457-M04
Species: Hu
Applications: WB, ELISA
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB600-230
Species: Hu
Applications: WB
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
38160002
Species: Hu
Applications: WB, ELISA
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-86513
Species: Hu
Applications: IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00005459-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for POU4F3 Antibody (H00005459-M01PCP) (0)

There are no publications for POU4F3 Antibody (H00005459-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU4F3 Antibody (H00005459-M01PCP) (0)

There are no reviews for POU4F3 Antibody (H00005459-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POU4F3 Antibody (H00005459-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POU4F3 Products

Bioinformatics Tool for POU4F3 Antibody (H00005459-M01PCP)

Discover related pathways, diseases and genes to POU4F3 Antibody (H00005459-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU4F3 Antibody (H00005459-M01PCP)

Discover more about diseases related to POU4F3 Antibody (H00005459-M01PCP).
 

Pathways for POU4F3 Antibody (H00005459-M01PCP)

View related products by pathway.

PTMs for POU4F3 Antibody (H00005459-M01PCP)

Learn more about PTMs related to POU4F3 Antibody (H00005459-M01PCP).
 

Research Areas for POU4F3 Antibody (H00005459-M01PCP)

Find related products by research area.

Blogs on POU4F3

There are no specific blogs for POU4F3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POU4F3 Antibody (5B8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol POU4F3