POU3F2/OCT7 Antibody (6F6)

Images

 
Western Blot: POU3F2/OCT7 Antibody (6F6) [H00005454-M01] - POU3F2 monoclonal antibody (M01), clone 6F6. Analysis of POU3F2 expression in Hela S3 NE.
Western Blot: POU3F2/OCT7 Antibody (6F6) [H00005454-M01] - Analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody (M01), clone 6F6.Lane 1: POU3F2 transfected lysate(46.9 KDa).Lane 2: ...read more
Sandwich ELISA: POU3F2/OCT7 Antibody (6F6) [H00005454-M01] - Detection limit for recombinant GST tagged POU3F2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POU3F2/OCT7 Antibody (6F6) Summary

Immunogen
POU3F2 (NP_005595, 1 a.a. - 67 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
Specificity
POU3F2 - POU domain, class 3, transcription factor 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POU3F2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00005454-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POU3F2/OCT7 Antibody (6F6)

  • Brain-2
  • Brain-specific homeobox/POU domain protein 2
  • BRN2
  • brn-2
  • BRN2brain-2
  • Nervous system-specific octamer-binding transcription factor N-Oct-3
  • Oct7
  • oct-7
  • OCT7POU domain class 3, transcription factor 2
  • Octamer-binding protein 7
  • Octamer-binding transcription factor 7
  • OTF7
  • OTF-7
  • POU class 3 homeobox 2
  • POU domain, class 3, transcription factor 2
  • POU3F2
  • POUF3

Background

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49872
Species: Mu, Rt
Applications: WB, PEP-ELISA
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-58020
Species: Hu
Applications: ICC/IF
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-85410
Species: Hu
Applications: IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA

Publications for OCT7 Antibody (H00005454-M01)(1)

Reviews for OCT7 Antibody (H00005454-M01) (0)

There are no reviews for OCT7 Antibody (H00005454-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCT7 Antibody (H00005454-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POU3F2/OCT7 Products

Bioinformatics Tool for OCT7 Antibody (H00005454-M01)

Discover related pathways, diseases and genes to OCT7 Antibody (H00005454-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCT7 Antibody (H00005454-M01)

Discover more about diseases related to OCT7 Antibody (H00005454-M01).
 

Pathways for OCT7 Antibody (H00005454-M01)

View related products by pathway.

PTMs for OCT7 Antibody (H00005454-M01)

Learn more about PTMs related to OCT7 Antibody (H00005454-M01).
 

Research Areas for OCT7 Antibody (H00005454-M01)

Find related products by research area.

Blogs on POU3F2/OCT7

There are no specific blogs for POU3F2/OCT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POU3F2/OCT7 Antibody (6F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F2
Entrez
OMIM
Uniprot