Recombinant Human Porimin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Porimin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 208 of Human TMEM123 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII

Protein/Peptide Type
Recombinant Protein
Gene
TMEM123

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Porimin Protein

  • KCT3
  • KCT-3
  • KCT3keratinocytes associated transmembrane protein 3
  • Keratinocytes-associated transmembrane protein 3
  • Porimin
  • PORIMINporimin
  • pro oncosis receptor inducing membrane injury
  • Pro-oncosis receptor inducing membrane injury
  • serine/threonine-rich receptor
  • TMEM123
  • transmembrane protein 123PORMIN

Background

This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56261
Species: Hu
Applications: WB, ICC/IF
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu

Publications for Porimin Recombinant Protein (H00114908-P01) (0)

There are no publications for Porimin Recombinant Protein (H00114908-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Porimin Recombinant Protein (H00114908-P01) (0)

There are no reviews for Porimin Recombinant Protein (H00114908-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Porimin Recombinant Protein (H00114908-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Porimin Products

Bioinformatics Tool for Porimin Recombinant Protein (H00114908-P01)

Discover related pathways, diseases and genes to Porimin Recombinant Protein (H00114908-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Porimin Recombinant Protein (H00114908-P01)

Discover more about diseases related to Porimin Recombinant Protein (H00114908-P01).
 

Pathways for Porimin Recombinant Protein (H00114908-P01)

View related products by pathway.

PTMs for Porimin Recombinant Protein (H00114908-P01)

Learn more about PTMs related to Porimin Recombinant Protein (H00114908-P01).
 

Research Areas for Porimin Recombinant Protein (H00114908-P01)

Find related products by research area.

Blogs on Porimin

There are no specific blogs for Porimin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Porimin Antibody
NB100-56371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Porimin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM123
Entrez