Porimin Antibody

Images

 
Western Blot: PORIMIN Antibody [NBP1-69491] - This Anti-TMEM123 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Porimin Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM123(transmembrane protein 123) The peptide sequence was selected from the C terminal of TMEM123. Peptide sequence SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM123
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM123 and was validated on Western blot.
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Porimin Antibody

  • KCT3
  • KCT-3
  • KCT3keratinocytes associated transmembrane protein 3
  • Keratinocytes-associated transmembrane protein 3
  • Porimin
  • PORIMINporimin
  • pro oncosis receptor inducing membrane injury
  • Pro-oncosis receptor inducing membrane injury
  • serine/threonine-rich receptor
  • TMEM123
  • transmembrane protein 123PORMIN

Background

TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56261
Species: Hu
Applications: WB, ICC/IF
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu

Publications for Porimin Antibody (NBP1-69491) (0)

There are no publications for Porimin Antibody (NBP1-69491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Porimin Antibody (NBP1-69491) (0)

There are no reviews for Porimin Antibody (NBP1-69491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Porimin Antibody (NBP1-69491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Porimin Products

Bioinformatics Tool for Porimin Antibody (NBP1-69491)

Discover related pathways, diseases and genes to Porimin Antibody (NBP1-69491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Porimin Antibody (NBP1-69491)

Discover more about diseases related to Porimin Antibody (NBP1-69491).
 

Pathways for Porimin Antibody (NBP1-69491)

View related products by pathway.

PTMs for Porimin Antibody (NBP1-69491)

Learn more about PTMs related to Porimin Antibody (NBP1-69491).
 

Research Areas for Porimin Antibody (NBP1-69491)

Find related products by research area.

Blogs on Porimin

There are no specific blogs for Porimin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Porimin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM123
Entrez
Uniprot