Porimin Antibody (1F4)

Images

 
Western Blot: Porimin Antibody (1F4) [H00114908-M02] - Analysis of TMEM123 expression in transfected 293T cell line by TMEM123 monoclonal antibody (M02), clone 1F4.Lane 1: TMEM123 transfected lysate (Predicted MW: 21.5 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Porimin Antibody (1F4) Summary

Immunogen
PORIMIN (NP_443164, 34 a.a. ~ 134 a.a) partial recombinant protein with GST tag.ETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAA SNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVT HNSSVTSAASSVTITT
Specificity
PORIMIN - pro-oncosis receptor inducing membrane injury gene
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TMEM123
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Porimin Antibody (1F4)

  • KCT3
  • KCT-3
  • KCT3keratinocytes associated transmembrane protein 3
  • Keratinocytes-associated transmembrane protein 3
  • Porimin
  • PORIMINporimin
  • pro oncosis receptor inducing membrane injury
  • Pro-oncosis receptor inducing membrane injury
  • serine/threonine-rich receptor
  • TMEM123
  • transmembrane protein 123PORMIN

Background

This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56261
Species: Hu
Applications: WB, ICC/IF
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu

Publications for Porimin Antibody (H00114908-M02) (0)

There are no publications for Porimin Antibody (H00114908-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Porimin Antibody (H00114908-M02) (0)

There are no reviews for Porimin Antibody (H00114908-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Porimin Antibody (H00114908-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Porimin Products

Bioinformatics Tool for Porimin Antibody (H00114908-M02)

Discover related pathways, diseases and genes to Porimin Antibody (H00114908-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Porimin Antibody (H00114908-M02)

Discover more about diseases related to Porimin Antibody (H00114908-M02).
 

Pathways for Porimin Antibody (H00114908-M02)

View related products by pathway.

PTMs for Porimin Antibody (H00114908-M02)

Learn more about PTMs related to Porimin Antibody (H00114908-M02).
 

Research Areas for Porimin Antibody (H00114908-M02)

Find related products by research area.

Blogs on Porimin

There are no specific blogs for Porimin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Porimin Antibody (1F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM123
Entrez
OMIM
Uniprot