POP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: POP1 Antibody [NBP2-68837] - Staining of human cell line PC-3 shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for POP1 Antibody

  • EC 3.1.26.5
  • hPOP1
  • KIAA0061
  • MGC17365
  • processing of precursor 1, ribonuclease P/MRP subunit (S. cerevisiae)
  • processing of precursors 1
  • ribonucleases P/MRP protein subunit POP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98337
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-57218
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC, IHC-P
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13260
Species: Hu
Applications: WB, ICC/IF, KD
NBP2-66088
Species: Hu
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP1-88765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83286
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-59476
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-59631
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC, IHC-P, ICC

Publications for POP1 Antibody (NBP2-68837) (0)

There are no publications for POP1 Antibody (NBP2-68837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POP1 Antibody (NBP2-68837) (0)

There are no reviews for POP1 Antibody (NBP2-68837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POP1 Antibody (NBP2-68837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POP1 Products

Bioinformatics Tool for POP1 Antibody (NBP2-68837)

Discover related pathways, diseases and genes to POP1 Antibody (NBP2-68837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POP1 Antibody (NBP2-68837)

Discover more about diseases related to POP1 Antibody (NBP2-68837).
 

Pathways for POP1 Antibody (NBP2-68837)

View related products by pathway.

PTMs for POP1 Antibody (NBP2-68837)

Learn more about PTMs related to POP1 Antibody (NBP2-68837).

Blogs on POP1

There are no specific blogs for POP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POP1