PON1 Antibody (2H7)

Images

 
Sandwich ELISA: PON1 Antibody (2H7) [H00005444-M01] - Detection limit for recombinant GST tagged PON1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PON1 Antibody (2H7) Summary

Immunogen
PON1 (NP_000437 246 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Specificity
PON1 - paraoxonase 1 (2H7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PON1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00005444-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PON1 Antibody (2H7)

  • A-esterase 1
  • Aromatic esterase 1
  • arylesterase B-type
  • EC 3.1.1.2
  • EC 3.1.1.81
  • EC 3.1.8.1
  • ESA
  • ESAesterase A
  • K-45
  • MVCD5
  • paraoxonase 1
  • PON 1
  • PON1
  • PONparaoxonase B-type
  • serum aryldiakylphosphatase
  • Serum aryldialkylphosphatase 1
  • serum paraoxonase/arylesterase 1

Background

The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4344
Species: Hu
Applications: WB
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4345
Species: Hu, Mu, Rt
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
H00005444-M01
Species: Hu
Applications: WB, ELISA

Publications for PON1 Antibody (H00005444-M01)(1)

Reviews for PON1 Antibody (H00005444-M01) (0)

There are no reviews for PON1 Antibody (H00005444-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PON1 Antibody (H00005444-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PON1 Products

Bioinformatics Tool for PON1 Antibody (H00005444-M01)

Discover related pathways, diseases and genes to PON1 Antibody (H00005444-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PON1 Antibody (H00005444-M01)

Discover more about diseases related to PON1 Antibody (H00005444-M01).
 

Pathways for PON1 Antibody (H00005444-M01)

View related products by pathway.

PTMs for PON1 Antibody (H00005444-M01)

Learn more about PTMs related to PON1 Antibody (H00005444-M01).
 

Research Areas for PON1 Antibody (H00005444-M01)

Find related products by research area.

Blogs on PON1

There are no specific blogs for PON1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PON1 Antibody (2H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PON1
Entrez
Uniprot