Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein

Order Details


    • Catalog Number
      H00002591-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-96 of Human GALNT3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
GALNT3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein

  • EC 2.4.1.41
  • GalNAc transferase 3
  • GalNAc-T3
  • GalNAc-T3DKFZp686C10199
  • GALNT3
  • HFTC
  • HFTCMGC61909
  • HHS
  • HHSPolypeptide GalNAc transferase 3
  • polypeptide GalNAc-transferase T3
  • polypeptide N-acetylgalactosaminyltransferase 3
  • pp-GaNTase 3
  • Protein-UDP acetylgalactosaminyltransferase 3
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 3 (GalNAc-T3)

Background

This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

2629-FG/CF
Species: Mu
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
AF2969
Species: Mu
Applications: WB, IP
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-86059
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
H00002591-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01) (0)

There are no publications for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01) (0)

There are no reviews for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Polypeptide GalNac Transferase 3/GALNT3 Products

Bioinformatics Tool for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01)

Discover related pathways, diseases and genes to Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01)

Discover more about diseases related to Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01).
 

Pathways for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01)

View related products by pathway.

PTMs for Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01)

Learn more about PTMs related to Polypeptide GalNac Transferase 3/GALNT3 Partial Recombinant Protein (H00002591-Q01).

Blogs on Polypeptide GalNac Transferase 3/GALNT3

There are no specific blogs for Polypeptide GalNac Transferase 3/GALNT3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT3
Entrez